ESMFold2 Tools logoESMFold2 Tools logoESMFold2 Tools
HomePredict
  • What is ESMFold2

    Definition, release context, and model scope

  • GitHub guide

    Repository, examples, Colab, and license notes

  • Biohub

    Official model, API, GitHub, and Atlas sources

  • ESM Atlas

    How ESMFold2 relates to the Biohub atlas

  • API

    Generate and understand Biohub API code

  • Code Generator

    Create starter Python code for ESMFold2

  • Example result

    Inspect a precomputed ESMFold2 structure in your browser

  • ESMFold2 vs AlphaFold3

    Compare scope, claims, and practical workflow

  • ESMFold2 vs ESMFold

    Clarify old ESMFold and new ESMFold2 search intent

Wishlist
ESMFold2 Tools logoESMFold2 Tools logoESMFold2 Tools

A third-party ESMFold2 guide, code generator, input builder, and structure inspection toolkit.

Learn
  • What is ESMFold2
  • GitHub
  • Biohub
  • ESM Atlas
  • API
Tools
  • Code Generator
  • Feature wishlist
Compare
  • vs AlphaFold3
  • vs ESMFold
About
  • About
  • Contact
  • Privacy
  • Terms
  • Acceptable Use
© 2026 ESMFold2 Tools. All Rights Reserved.
ESMFold2 - Featured on Startup Fameyo.directory

Browser-local tool

ESMFold2 Code Generator

Generate starter code for ESMFold2 examples without sending your sequence or token anywhere. Use the output as a scaffold and verify client imports against current official Biohub documentation before running.

ESMFold2 Quick Starter

Generate starter Python locally in your browser. Do not paste a private Biohub token here.

# !pip install <official Biohub ESMFold2 client package>
# Last verified: update against the current Biohub ESMFold2 docs before running.
# Official sources: https://biohub.ai/models/esmfold2 and https://github.com/Biohub/esm

import os

MODEL_ID = "esmfold2-fast-2026-05"  # Verify model ID in official docs.
BIOHUB_TOKEN = os.environ["BIOHUB_TOKEN"]

# Replace these imports/client calls with the current official Biohub example.
from official_esmfold2_client import (
    ESMFold2Client,
    FoldingConfig,
    StructurePredictionInput,
)

client = ESMFold2Client(
    model=MODEL_ID,
    token=BIOHUB_TOKEN,
)

prediction_input = StructurePredictionInput(
    proteins=[{"id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVE"}],
)

result = client.fold_all_atom(
    prediction_input,
    config=FoldingConfig(
        num_loops=1,
        num_sampling_steps=8,
        include_pae=True,
    ),
)

with open("esmfold2_result.cif", "w") as handle:
    handle.write(result.mmcif)
Open full code generator

How to use this generator

Choose the prediction type, output mode, and whether the scaffold should request PAE output. The tool then prepares a minimal Python example with a model placeholder, token placeholder, folding configuration, and mmCIF save path.

Use the result as a starting point, not as permanent API documentation. Before running it in Colab or locally, compare the imports and client setup with the current Biohub model page, GitHub repository, and official Colab.

What the tool will not do

The generator does not send your sequence to a backend, store API tokens, proxy Biohub, or create predicted coordinates. Track A is intentionally limited to browser-local preparation and explanation.

Hosted prediction is a separate Phase 2 product decision. It would require real ESMFold2 inference, sign-in, usage-based credits, job queues, result retention rules, and biosafety screening before launch.

Safe defaults

  • Use placeholders for private tokens.
  • Verify official imports before running.
  • Save outputs locally in your own environment.
  • Do not treat predictions as experimental validation.

Token-safe by design

The generated code uses environment variables and placeholders. Do not paste private Biohub tokens into browser tools.

Official-docs first

Model IDs, package names, and client classes should be checked against the official model page or GitHub repository.

Track A only

This free tool does not proxy Biohub APIs or run hosted predictions. Paid hosted prediction is a later compliance-gated phase.

FAQ

Does the ESMFold2 code generator run predictions?

No. It only generates starter code in the browser. It does not call Biohub APIs, run GPUs, or upload sequences.

Should I paste my Biohub token into this tool?

No. Generated code uses placeholders and environment variables so private tokens stay in your own runtime.

Is the generated code guaranteed to run unchanged?

No. Treat it as a scaffold and verify imports, model IDs, and package commands against current Biohub documentation.

Can this tool generate arbitrary ligand workflows?

No. It only mirrors safe starter patterns and should not be read as support for arbitrary small-molecule docking.

Written by ESMFold2 Tools Editorial Team

Fact-checked against Biohub official docs, GitHub examples, and linked primary sources.

Last updated May 29, 2026

Official sources

Biohub model pageGitHub repositoryOfficial Colab